A vintage photograph divided into four panels, documenting a sequence of an early flying machine attempt.
personaircrafttreesgrassskywheelsframewinggroundlandscapetextvintagehistoricalaviationearly flightbiplaneflying machineexperimentmantreesgrassskywheelsframewinggroundlandscapetext

The image is a vintage photograph divided into four panels, documenting a sequence of an early flying machine attempt. **Panel 1:** Shows a man standing beside a biplane-like aircraft. The aircraft has two large wheels on either side, connected by a frame and supporting a wing. The man is dressed in a suit and appears to be inspecting or preparing the machine. Trees are visible in the background. **Panel 2:** Depicts the aircraft in mid-flight, with the wheels and frame visible. It's a side view, showing the machine attempting to lift off. The background consists of trees and a clear sky. **Panel 3 & 4:** These panels show the aircraft in various stages of flight or descent. The machine appears to be losing altitude, with the wheels and frame becoming more prominent as it falls. The background is a grassy field with a clear sky. The overall tone of the image is historical and documentary, capturing a moment in the early days of aviation. The quality of the photograph is grainy and aged, adding to its vintage feel. There is handwritten text on the top right of panel 2. Below the panels is the text 'PLATE XV'.


License: CC0